PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj0g3v0134389.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family WOX
Protein Properties Length: 276aa    MW: 31541.1 Da    PI: 9.3529
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj0g3v0134389.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox54.61.9e-1753113257
                      T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
         Homeobox   2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                      r+R+++++eq+ +Le+ F++   +p ++e++++ ++l    ++ +++V++WFqNr+ + k+
  Lj0g3v0134389.1  53 RPRWNPKPEQICILEAIFNSgMVNPPRDEIRKIRMQLqeygQVGDANVFYWFQNRKSRSKH 113
                      89*****************99*************************************995 PP

2Wus_type_Homeobox111.83.6e-3652114264
  Wus_type_Homeobox   2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64 
                        +r+RW+P+peQi iLe++++sG+++P+++ei++i+++L+eyG+++d+NVfyWFQNrk+R+++k
    Lj0g3v0134389.1  52 PRPRWNPKPEQICILEAIFNSGMVNPPRDEIRKIRMQLQEYGQVGDANVFYWFQNRKSRSKHK 114
                        689**********************************************************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.75E-1247117IPR009057Homeodomain-like
PROSITE profilePS5007110.0949114IPR001356Homeobox domain
SMARTSM003893.5E-851118IPR001356Homeobox domain
CDDcd000864.12E-752114No hitNo description
Gene3DG3DSA:1.10.10.601.9E-752122IPR009057Homeodomain-like
PfamPF000464.8E-1553113IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 276 aa     Download sequence    Send to blast
MAASNKSWPS MFKSKRNPNH QWHHDINSSL LSTGFQRTPY ASGGGDERTP EPRPRWNPKP  60
EQICILEAIF NSGMVNPPRD EIRKIRMQLQ EYGQVGDANV FYWFQNRKSR SKHKLRNQQN  120
SKKNNNNQEP QKINQTVPNS SSSSSSEKST PKEVTVTPSV GFYSNDIDVV PNSPTPSVNQ  180
TLFQTNFQLP PVADPFSFAM NQEVVVHNVM ETQGFHFTEL SNIIQPPPSQ YEQNLGQWLT  240
TTNNIMSFET TKKDQDNFMT MMHQPQHNFS LTPAPT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003541514.19e-90PREDICTED: WUSCHEL-related homeobox 9-like
TrEMBLI1M0489e-90I1M048_SOYBN; Uncharacterized protein
STRINGGLYMA13G24150.13e-89(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33880.11e-59homeobox-3